HPA023378

BRF2 antibody from Sigma-Aldrich
BRFU, FLJ11052, TFIIIB50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023378
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023378, RRID:AB_1845446
Product name
Anti-BRF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023378
Antibody type
Polyclonal
Antigen
Transcription factor IIIB 50 kDa subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGL
RRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Storage
-20C
Provider Type Product Number
- No reagents -