Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183902 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ribosomal Protein L32 (RPL32) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPL32 antibody: synthetic peptide directed towards the N terminal of human RPL32
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWR
KPRGI DNRVRRRFKG- Vial size
- 0.1 mg
Submitted references Encapsulated pheochromocytoma cells secrete potent noncatecholamine factors.
Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
Mobine HR, Engelmayr GC Jr, Moussazadeh N, Anwar TR, Freed LE, Edelman ER
Tissue engineering. Part A 2009 Jul;15(7):1719-28
Tissue engineering. Part A 2009 Jul;15(7):1719-28
Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
Dias Neto E, Correa RG, Verjovski-Almeida S, Briones MR, Nagai MA, da Silva W Jr, Zago MA, Bordin S, Costa FF, Goldman GH, Carvalho AF, Matsukuma A, Baia GS, Simpson DH, Brunstein A, de Oliveira PS, Bucher P, Jongeneel CV, O'Hare MJ, Soares F, Brentani RR, Reis LF, de Souza SJ, Simpson AJ
Proceedings of the National Academy of Sciences of the United States of America 2000 Mar 28;97(7):3491-6
Proceedings of the National Academy of Sciences of the United States of America 2000 Mar 28;97(7):3491-6
No comments: Submit comment
No validations: Submit validation data