HPA022145

ASPA antibody from Sigma-Aldrich
ACY2, ASP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022145
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022145, RRID:AB_1845103
Product name
Anti-ASPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022145
Antibody type
Polyclonal
Antigen
Aspartoacylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGA
EIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRI
Storage
-20C
Provider Type Product Number
- No reagents -