HPA003414

PITPNM2 antibody from Sigma-Aldrich
NIR3, RDGB2, RDGBA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003414
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003414, RRID:AB_1855410
Product name
Anti-PITPNM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003414
Antibody type
Polyclonal
Antigen
Membrane-associated phosphatidylinositol transfer protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPE
FRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVL
HGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHY
PSALGRLAIRLVPCPPVCSDAFALVSN
Storage
-20C
Provider Type Product Number
- No reagents -