HPA003978

PITPNM2 antibody from MilliporeSigma / Merck KGaA
NIR3, RDGB2, RDGBA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003978
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-PITPNM2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA003978
Antibody type
Polyclonal
Antigen
Membrane-associated phosphatidylinositol transfer protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVVSMQDNDLLSPGILMNAAHCCGGGGGGGGGGGS
SGGGGSSGGSSLESSRHLSRSNVDIPRSNGTEDPK
RQLPRKRSDSSTYELDTIQQHQAFLSSLHASVLRT
EPCSRHSSSST
Storage
-20C