Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005209-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005209-M08, RRID:AB_1112017
- Product name
- PFKFB3 monoclonal antibody (M08), clone 3F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PFKFB3.
- Antigen sequence
CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERS
EDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEE
HVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADS
SRKH- Isotype
- IgG
- Antibody clone number
- 3F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway.
Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo.
Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, Kamata A, Sakamoto K, Nakanishi T, Kubo A, Hishiki T, Suematsu M
Nature communications 2014 Mar 17;5:3480
Nature communications 2014 Mar 17;5:3480
Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo.
Bao Y, Mukai K, Hishiki T, Kubo A, Ohmura M, Sugiura Y, Matsuura T, Nagahata Y, Hayakawa N, Yamamoto T, Fukuda R, Saya H, Suematsu M, Minamishima YA
Molecular cancer research : MCR 2013 Sep;11(9):973-85
Molecular cancer research : MCR 2013 Sep;11(9):973-85
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3.Lane 1: PFKFB3 transfected lysate(59.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PFKFB3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol