Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449820 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 77 (ZNF77) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the N-terminal region of human ZNF77
- Description
- Peptide immunoaffinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LCESNEGHQCGETLSQTANLLVHKSYPTEAKPSEC
TKCGKAFENRQRSHT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Chromosomal localization of four human zinc finger cDNAs.
Huebner K, Druck T, LaForgia S, Lasota J, Croce CM, Lanfrancone L, Donti E, Pengue G, La Mantia G, Pelicci PG
Human genetics 1993 Apr;91(3):217-22
Human genetics 1993 Apr;91(3):217-22
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HeLa; WB Suggested Anti-ZNF77 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate; ZNF77 antibody - N-terminal region (AP43053PU-N) in Human HeLa cells using Western Blot
