HPA044647

GNPNAT1 antibody from Atlas Antibodies
FLJ10607, Gpnat1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044647
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044647, RRID:AB_10795986
Product name
Anti-GNPNAT1
Provider product page
Atlas Antibodies - HPA044647
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLV
LRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSF
EHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFI
HSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLS
KKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCR
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -