HPA002031

MBD4 antibody from Sigma-Aldrich
MED1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002031
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002031, RRID:AB_1079319
Product name
Anti-MBD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002031
Antibody type
Polyclonal
Antigen
Methyl-CpG-binding domain protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQES
RGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVT
ILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKA
DAESEPVAQKSQLDRTVCISDAGACGETLSVTSEE
N
Storage
-20C
Provider Type Product Number
- No reagents -