Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183882 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ZFP57 Zinc Finger Protein (ZFP57) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFP57 antibody: synthetic peptide directed towards the N terminal of human ZFP57
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MFEQLKPIEPRDCWREARVKKKPVTFEDVAVNFTQ
EEWDC LDASQRVLYQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of ZFP-57, a novel zinc finger transcription factor in the mammalian peripheral nervous system.
Alonso MB, Zoidl G, Taveggia C, Bosse F, Zoidl C, Rahman M, Parmantier E, Dean CH, Harris BS, Wrabetz L, Müller HW, Jessen KR, Mirsky R
The Journal of biological chemistry 2004 Jun 11;279(24):25653-64
The Journal of biological chemistry 2004 Jun 11;279(24):25653-64
No comments: Submit comment
No validations: Submit validation data