HPA010703

DNASE1 antibody from Sigma-Aldrich
DNL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010703
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010703, RRID:AB_10600806
Product name
Anti-DNASE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010703
Antibody type
Polyclonal
Antigen
deoxyribonuclease I recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHC
AYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQ
LAQAISDHY
Storage
-20C
Provider Type Product Number
- No reagents -