HPA002042

C1QTNF6 antibody from Sigma-Aldrich
CTRP6, ZACRP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002042
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002042, RRID:AB_1078342
Product name
Anti-C1QTNF6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002042
Antibody type
Polyclonal
Antigen
Complement C1q tumor necrosis factor-related protein 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYI
NITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGS
KGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDF
QTLLFERVFVNLDGCFDMATGQFAAPLR
Storage
-20C
Provider Type Product Number
- No reagents -