HPA005819

ARMT1 antibody from Sigma-Aldrich
C6orf211, FLJ12910
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005819
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005819, RRID:AB_1845741
Product name
Anti-C6orf211 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005819
Antibody type
Polyclonal
Antigen
UPF0364 protein C6orf211 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTT
IHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKW
VYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLIL
FKGDLNYRKLTGDRK
Storage
-20C
Provider Type Product Number
- No reagents -