HPA019469

ZFAND2A antibody from Sigma-Aldrich
AIRAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019469
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019469, RRID:AB_1859009
Product name
Anti-ZFAND2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019469
Antibody type
Polyclonal
Antigen
AN1-type zinc finger protein 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSK
EGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHG
SRPTIKAG
Storage
-20C
Provider Type Product Number
- No reagents -