HPA018856

GPATCH2L antibody from Sigma-Aldrich
C14orf118, FLJ10033, FLJ20689
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018856, RRID:AB_1845553
Product name
Anti-C14orf118 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018856
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf118 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRRSDFTHLAEHTCCYSEASESSLDEATKDCREVA
PVTNFSDSDDTMVAKRHPALNAIVKSKQHSWHESD
SFTENAPCRPLRRRRKVKRVTSEVAASLQQKLKVS
DWSYERGCRFKSAKK
Storage
-20C
Provider Type Product Number
- No reagents -