ABIN630673

antibody from antibodies-online

Targeting: MSL2 FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630673 - Provider product page
Provider: antibodies-online
Product name: anti-Male-Specific Lethal 2 Homolog (Drosophila) (MSL2) antibody
Antibody type: Polyclonal
Antigen: MSL2 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

MSL2 protein structure - ABIN630673 shown in red.