H00008347-A01

H2BC4 antibody from Abnova Corporation
H2B.1, H2B/l, H2BFL, HIST1H2BC
No application information provided.

Antibody data

Product number
H00008347-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008347-A01, RRID:AB_461777
Product name
HIST1H2BC polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00008347-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant HIST1H2BC.
Antigen sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRK
ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPG
ELAKHAVSEGTKAVTKYTSSK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -