HPA005769

TCP11L1 antibody from Sigma-Aldrich
FLJ11336
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005769
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005769, RRID:AB_2202398
Product name
Anti-TCP11L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005769
Antibody type
Polyclonal
Antigen
T-complex protein 11-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEAL
QKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETAR
GVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKE
IVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET
Storage
-20C
Provider Type Product Number
- No reagents -