HPA035914

GPR82 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035914
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035914, RRID:AB_10670671
Product name
Anti-GPR82
Provider product page
Atlas Antibodies - HPA035914
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQ
PNFAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -