HPA003340

S100A10 antibody from Atlas Antibodies
42C, ANX2LG, CAL1L, CLP11, P11
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003340
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003340, RRID:AB_1856531
Product name
Anti-S100A10
Provider product page
Atlas Antibodies - HPA003340
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLM
EKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -