HPA003340

S100A10 antibody from Sigma-Aldrich
42C, ANX2LG, CAL1L, CLP11, P11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003340
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003340, RRID:AB_1856531
Product name
Anti-S100A10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003340
Antibody type
Polyclonal
Antigen
Protein S100-A10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLM
EKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Storage
-20C
Provider Type Product Number
- No reagents -