HPA003281

PTP4A1 antibody from Sigma-Aldrich
PRL-1, PTPCAAX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003281
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003281, RRID:AB_1855903
Product name
Anti-PTP4A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003281
Antibody type
Polyclonal
Antigen
Protein tyrosine phosphatase type IVA 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTL
VEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKF
REEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYE
DAVQFIRQKRRGAFNSKQLLYLEKYRPKM
Storage
-20C
Provider Type Product Number
- No reagents -