Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005026-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005026-M01, RRID:AB_509232
- Product name
- P2RX5 monoclonal antibody (M01), clone 1C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant P2RX5.
- Antigen sequence
DGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLAR
GTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNH
IRFPKFNFSKSNVMDVKDRSFLKSCHFGP- Isotype
- IgG
- Antibody clone number
- 1C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A truncation variant of the cation channel P2RX5 is upregulated during T cell activation.
Abramowski P, Ogrodowczyk C, Martin R, Pongs O
PloS one 2014;9(9):e104692
PloS one 2014;9(9):e104692
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of P2RX5 expression in transfected 293T cell line by P2RX5 monoclonal antibody (M01), clone 1C5.Lane 1: P2RX5 transfected lysate(46.42 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged P2RX5 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol