Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-C121206 - Provider product page
- Provider
- LSBio
- Product name
- Anti-TFF1 / pS2 Antibody (aa54-84) LS-C121206
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2. Epitope: Amino acids 54 - 84. Percent identity by BLAST analysis: Human (100%); Gorilla (97%); Gibbon (90%); Monkey (87%); Marmoset (81%).
- Description
- Protein G purified
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 500µl
- Storage
- May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C
No comments: Submit comment
No validations: Submit validation data