LS-C121206

antibody from LSBio

Targeting: TFF1 BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: LS-C121206 - Provider product page
Provider: LSBio
Product name: Anti-TFF1 / pS2 Antibody (aa54-84) LS-C121206
Antibody type: Monoclonal
Antigen: Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2. Epitope: Amino acids 54 - 84. Percent identity by BLAST analysis: Human (100%); Gorilla (97%); Gibbon (90%); Monkey (87%); Marmoset (81%).
Description: Protein G purified
Reactivity: Human
Host: Mouse
Isotype: IgG
Vial size: 500µl
Storage: May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C

TFF1 protein structure - LS-C121206 shown in red.