Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARG62611 - Provider product page

- Provider
- Arigo
- Product name
- anti-pS2 / Trefoil factor 1 antibody [pS2.1]
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF, corresponding to amino acids 54-84 of Human pS2.
- Description
- Protein G purified
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Antibody clone number
- pS2.1
- Vial size
- 500 µl
- Concentration
- 0.2 mg/ml
- Storage
- For continuous use, store undiluted antibody at 2-8°C for up to 1-2 weeks. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. The antibody solution should be gently mixed before use.
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
No validations: Submit validation data