Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN2744762 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Trefoil Factor 1 (TFF1) (AA 54-84), (C-Term) antibody
- Antibody type
- Monoclonal
- Antigen
- A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein. Percent identity by BLAST analysis: Human (100%), Monkey (87%).ImmunogenType: Synthetic peptide
- Description
- Protein G purified
- Reactivity
- Human
- Host
- Mouse
- Epitope
- AA 54-84,C-Term
- Isotype
- IgG
- Antibody clone number
- pS2-1
- Vial size
- 0.2 mL
- Storage
- Stable for 36 months when stored at or below 0°C.
No comments: Submit comment
No validations: Submit validation data