H00007031-M03
antibody from Abnova Corporation
Targeting: TFF1
BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007031-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007031-M03, RRID:AB_464066
- Product name
- TFF1 monoclonal antibody (M03), clone M1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TFF1.
- Antigen sequence
MATMENKVICALVLVSMLALGTLAEAQTETCTVAP
RERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF- Isotype
- IgG
- Antibody clone number
- M1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of the human gastric fluid proteome reveals distinct pH-dependent protein profiles: implications for biomarker studies.
Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL
Journal of proteome research 2011 Oct 7;10(10):4535-46
Journal of proteome research 2011 Oct 7;10(10):4535-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFF1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol