Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- MA5-11507 - Provider product page
- Provider
- Invitrogen Antibodies
- Product name
- TFF1 Monoclonal Antibody (pS2.1)
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide
- Description
- MA5-11507 targets pS2/pNR-2 Estrogen-Regulated Protein in IHC applications and shows reactivity with Human samples. The MA5-11507 immunogen is a Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Antibody clone number
- pS2.1
- Vial size
- 500 µL
- Concentration
- 0.2 mg/mL
- Storage
- 4° C
Submitted references Coordinate late expression of trefoil peptide genes (pS2/TFF1 and ITF/TFF3) in human breast, colon, and gastric tumor cells exposed to X-rays.
Balcer-Kubiczek EK, Harrison GH, Xu JF, Gutierrez PL
Molecular cancer therapeutics 2002 Apr;1(6):405-15
Molecular cancer therapeutics 2002 Apr;1(6):405-15
No comments: Submit comment
No validations: Submit validation data