HPA003425

antibody from Atlas Antibodies

Targeting: TFF1 BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2

Western blot (Enhanced validation)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA003425

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA003425, RRID:AB_1848260

Product name

Anti-TFF1

Antibody type

Polyclonal

Reactivity

Human

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDT
VRGVPWCFYPNTIDVPPE


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

Antibody-based protein profiling of the human chromosome 21.

Uhlén M, Oksvold P, Älgenäs C, Hamsten C, Fagerberg L, Klevebring D, Lundberg E, Odeberg J, Pontén F, Kondo T, Sivertsson Å
Molecular & cellular proteomics : MCP 2012 Mar;11(3):M111.013458

---

Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas.

Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS
Molecular & cellular proteomics : MCP 2010 Jun;9(6):1100-17

---

Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions

Davidson B, Stavnes H, Holth A, Chen X, Yang Y, Shih I, Wang T
Journal of Cellular and Molecular Medicine 2010 January

---

The Human Protein Atlas-a tool for pathology

Pontén F, Jirström K, Uhlen M
The Journal of Pathology 2008 December;216(4):387-393

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Western blot analysis in human cell lines MCF-7 and A-431 using Anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Orthogonal method

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Show more

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Recombinant expression validation

Main image

Experimental details

Western blot analysis in control (vector only transfected HEK293T lysate) and TFF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418822).

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human stomach and liver tissues using Anti-TFF1 antibody. Corresponding TFF1 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human stomach shows high expression.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human liver shows low expression as expected.

Sample type

HUMAN