HPA003425

TFF1 antibody from Atlas Antibodies
BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003425
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003425, RRID:AB_1848260
Product name
Anti-TFF1
Provider product page
Atlas Antibodies - HPA003425
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDT
VRGVPWCFYPNTIDVPPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -