HPA003425

TFF1 antibody from Sigma-Aldrich
BCEI, D21S21, HP1.A, HPS2, pNR-2, pS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003425
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003425, RRID:AB_1848260
Product name
Anti-TFF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003425
Antibody type
Polyclonal
Antigen
Trefoil factor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDT
VRGVPWCFYPNTIDVPPE
Storage
-20C
Provider Type Product Number
- No reagents -