HPA019198

TMEM43 antibody from Sigma-Aldrich
ARVD5, DKFZp586G1919, LUMA, MGC3222
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019198
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019198, RRID:AB_1858118
Product name
Anti-TMEM43 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019198
Antibody type
Polyclonal
Antigen
Transmembrane protein 43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVG
DLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQL
VPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMK
T
Storage
-20C
Provider Type Product Number
- No reagents -