HPA019198

TMEM43 antibody from Atlas Antibodies
ARVD5, DKFZp586G1919, LUMA, MGC3222
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019198
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019198, RRID:AB_1858118
Product name
Anti-TMEM43
Provider product page
Atlas Antibodies - HPA019198
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVG
DLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQL
VPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMK
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -