Antibody data

Product number
H00003672-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003672-M02, RRID:AB_1575653
Product name
ITGA1 monoclonal antibody (M02), clone 4G11
Provider product page
Abnova Corporation - H00003672-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ITGA1.
Antigen sequence
QFYSSASEYHISIAANETVPEVINSTEDIGNEINI
FYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLK
RGTI
Isotype
IgG
Antibody clone number
4G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -