Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28657 - Provider product page

- Provider
- Abnova Corporation
- Product name
- RAP1GAP polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant RAP1GAP.
- Antigen sequence
IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSE
NSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSS
SASSFASVVEETEGVDGEDTGLESVSSSGTP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with RAP1GAP polyclonal antibody (Cat # PAB28657).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Human cell line RT-4 with RAP1GAP polyclonal antibody (Cat # PAB28657).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with RAP1GAP polyclonal antibody (Cat # PAB28657) shows strong positivity in distal tubules and Bowman's capsule at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry