Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001922 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001922, RRID:AB_1079743
- Product name
- Anti-RAP1GAP
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSE
NSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSS
SASSFASVVEETEGVDGEDTGLESVSSSGTP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong positivity in distal tubules and Bowman's capsule.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse midbrain shows strong immunoreactivity in locus coeruleus neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cingulate cortex shows strong cytoplasmic positivity in neuronal cell bodies and proximal dendrites.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hypothalamus shows positivity in neuronal cell bodies and processes in the lateral preoptic area.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse globus pallidus shows strong cytoplasmic immunoreactivity in neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows cytoplasmic positivity in a subset of interneurons in the CA1 area.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic immunoreactivity in Purkinje cells and neurons in the molecular layer.
- Sample type
- HUMAN