HPA001922

RAP1GAP antibody from Atlas Antibodies
KIAA0474, RAP1GA1, RAP1GAP1, RAP1GAPII

Antibody data

Product number
HPA001922
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001922, RRID:AB_1079743
Product name
Anti-RAP1GAP
Provider product page
Atlas Antibodies - HPA001922
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSE
NSSTQSSPEMPTTKNRAETAAQRAEALKDFSRSSS
SASSFASVVEETEGVDGEDTGLESVSSSGTP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.