HPA001923

SOX6 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001923, RRID:AB_1080065
Product name
Anti-SOX6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001923
Antibody type
Polyclonal
Antigen
Transcription factor SOX-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYA
AQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNE
KRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPT
S
Storage
-20C
Provider Type Product Number
- No reagents -