ABIN629802

antibody from antibodies-online

Targeting: PPFIBP1 hSGT2, hSgt2p, L2, SGT2

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629802 - Provider product page
Provider: antibodies-online
Product name: anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) antibody
Antibody type: Polyclonal
Antigen: PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PPFIBP1 protein structure - ABIN629802 shown in red.