PAB20099

PPFIBP1 antibody from Abnova Corporation
hSGT2, hSgt2p, L2, SGT2

Antibody data

Product number
PAB20099
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20099, RRID:AB_10962675
Product name
PPFIBP1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20099
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant PPFIBP1.
Antigen sequence
DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFH
TTILQVSIPSLLPATVSMETSEKSKLTPKPETSFE
ENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLK
KETSDGEKETIQKTSEDRA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -