Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310286 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPFIBP1 antibody: synthetic peptide directed towards the N terminal of human PPFIBP1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIP
DSTAE TLVEWLQSQM- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Liprin beta 1, a member of the family of LAR transmembrane tyrosine phosphatase-interacting proteins, is a new target for the metastasis-associated protein S100A4 (Mts1).
Kriajevska M, Fischer-Larsen M, Moertz E, Vorm O, Tulchinsky E, Grigorian M, Ambartsumian N, Lukanidin E
The Journal of biological chemistry 2002 Feb 15;277(7):5229-35
The Journal of biological chemistry 2002 Feb 15;277(7):5229-35
No comments: Submit comment
No validations: Submit validation data