AV42133

PPFIBP1 antibody from Sigma-Aldrich
hSGT2, hSgt2p, L2, SGT2
No application information provided.

Antibody data

Product number
AV42133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV42133, RRID:AB_1855620
Product name
Anti-PPFIBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV42133
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PPFIBP1 with an internal ID of S11706
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QSPTSPFMGSLRALHLVEDLRGLLEMMETDEKEGL
RCQIPDSTAETLVEW
Storage
-20C
Provider Type Product Number
- No reagents -