HPA001924

PPFIBP1 antibody from Sigma-Aldrich
hSGT2, hSgt2p, L2, SGT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001924, RRID:AB_1079665
Product name
Anti-PPFIBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001924
Antibody type
Polyclonal
Antigen
Liprin-beta-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFH
TTILQVSIPSLLPATVSMETSEKSKLTPKPETSFE
ENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLK
KETSDGEKETIQKTSEDRA
Storage
-20C
Provider Type Product Number
- No reagents -