Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182680 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aquaporin 7 (AQP7) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AQP7 antibody: synthetic peptide directed towards the C terminal of human AQP7
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPAN
RSSVH PAPPLHESMA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human aquaporin adipose (AQPap) gene. Genomic structure, promoter analysis and functional mutation.
Kondo H, Shimomura I, Kishida K, Kuriyama H, Makino Y, Nishizawa H, Matsuda M, Maeda N, Nagaretani H, Kihara S, Kurachi Y, Nakamura T, Funahashi T, Matsuzawa Y
European journal of biochemistry / FEBS 2002 Apr;269(7):1814-26
European journal of biochemistry / FEBS 2002 Apr;269(7):1814-26
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting