Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001925 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001925, RRID:AB_1857756
- Product name
- Anti-TAGLN2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQC
RKDVGRPQPGRENFQNWLKDGTVLCELINALYPEG
QAPVKKIQASTMAFKQMEQISQFLQAAERYGINTT
DIFQTVDLWEGKNMACVQRTLMNLGGLA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
The tumour-suppressive function of miR-1 and miR-133a targeting TAGLN2 in bladder cancer.
miR-1 as a tumor suppressive microRNA targeting TAGLN2 in head and neck squamous cell carcinoma.
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
The tumour-suppressive function of miR-1 and miR-133a targeting TAGLN2 in bladder cancer.
Yoshino H, Chiyomaru T, Enokida H, Kawakami K, Tatarano S, Nishiyama K, Nohata N, Seki N, Nakagawa M
British journal of cancer 2011 Mar 1;104(5):808-18
British journal of cancer 2011 Mar 1;104(5):808-18
miR-1 as a tumor suppressive microRNA targeting TAGLN2 in head and neck squamous cell carcinoma.
Nohata N, Sone Y, Hanazawa T, Fuse M, Kikkawa N, Yoshino H, Chiyomaru T, Kawakami K, Enokida H, Nakagawa M, Shozu M, Okamoto Y, Seki N
Oncotarget 2011 Jan-Feb;2(1-2):29-42
Oncotarget 2011 Jan-Feb;2(1-2):29-42
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in bone marrow poietic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate to strong positivity in germinal center cells.
- Sample type
- HUMAN