HPA001925

TAGLN2 antibody from Sigma-Aldrich
HA1756, KIAA0120
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001925
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001925, RRID:AB_1857756
Product name
Anti-TAGLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001925
Antibody type
Polyclonal
Antigen
Transgelin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQC
RKDVGRPQPGRENFQNWLKDGTVLCELINALYPEG
QAPVKKIQASTMAFKQMEQISQFLQAAERYGINTT
DIFQTVDLWEGKNMACVQRTLMNLGGLA
Storage
-20C
Provider Type Product Number
- No reagents -