Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003673-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003673-M01, RRID:AB_606460
- Product name
- ITGA2 monoclonal antibody (M01), clone 2B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITGA2.
- Antigen sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLL
VGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQT
STSIPNVTEMKTNMSLGLIL- Isotype
- IgG
- Antibody clone number
- 2B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification and characterization of the integrin alpha2beta1 binding motif in chondroadherin mediating cell attachment.
Haglund L, Tillgren V, Addis L, Wenglén C, Recklies A, Heinegård D
The Journal of biological chemistry 2011 Feb 4;286(5):3925-34
The Journal of biological chemistry 2011 Feb 4;286(5):3925-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ITGA2 monoclonal antibody (M01), clone 2B6 Western Blot analysis of ITGA2 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ITGA2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ITGA2 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol