HPA023876

PSMG3 antibody from Atlas Antibodies
C7orf48, MGC10911, PAC3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023876
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023876, RRID:AB_1844356
Product name
Anti-PSMG3
Provider product page
Atlas Antibodies - HPA023876
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLL
GQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKD
KSMEGLKALREVIRVCQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -