HPA023876

PSMG3 antibody from Sigma-Aldrich
C7orf48, MGC10911, PAC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023876
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023876, RRID:AB_1844356
Product name
Anti-PSMG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023876
Antibody type
Polyclonal
Antigen
Proteasome assembly chaperone 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLL
GQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKD
KSMEGLKALREVIRVCQ
Storage
-20C
Provider Type Product Number
- No reagents -