HPA015028

SLC6A6 antibody from Sigma-Aldrich
TAUT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015028
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015028, RRID:AB_1857200
Product name
Anti-SLC6A6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015028
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent taurine transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKN
KSVWITISSTNFTSPVIEFWERNVLSLSPGIDHP
Storage
-20C
Provider Type Product Number
- No reagents -