Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015028 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015028, RRID:AB_1857200
- Product name
- Anti-SLC6A6
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKN
KSVWITISSTNFTSPVIEFWERNVLSLSPGIDHP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Osmolyte transporter expression is reduced in photoaged human skin: Implications for skin hydration in aging
Mechanism and effects of pulsatile GABA secretion from cytosolic pools in the human beta cell
Foster A, El Chami C, O'Neill C, Watson R
Aging Cell 2019;19(1)
Aging Cell 2019;19(1)
Mechanism and effects of pulsatile GABA secretion from cytosolic pools in the human beta cell
Menegaz D, Hagan D, AlmaƧa J, Cianciaruso C, Rodriguez-Diaz R, Molina J, Dolan R, Becker M, Schwalie P, Nano R, Lebreton F, Kang C, Sah R, Gaisano H, Berggren P, Baekkeskov S, Caicedo A, Phelps E
Nature Metabolism 2019;1(11):1110-1126
Nature Metabolism 2019;1(11):1110-1126
No comments: Submit comment
No validations: Submit validation data