HPA001601

G2E3 antibody from Atlas Antibodies
FLJ20333, KIAA1333, PHF7B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001601
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001601, RRID:AB_1079198
Product name
Anti-G2E3
Provider product page
Atlas Antibodies - HPA001601
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQAYPEAFCSILCHKPESLSAKILSELFTVHTLPD
VKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSS
IPPAGFKPTPSIECLHVDFPVGNKCNNCLAIPITN
TYKEFQENMDFTIRNT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -